PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05232.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 58aa    MW: 6811.77 Da    PI: 4.9113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05232.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM54.83.3e-171157148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             +ppGfrFhPt+eel+++yL+kk+++ k++l +vi++vd++k+ePwd++
  Rsa1.0_05232.1_g00002.1 11 VPPGFRFHPTEEELLQYYLRKKISNIKIDL-DVIRDVDLNKLEPWDIQ 57
                             69****************************.9**************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-18757IPR003441NAC domain
PROSITE profilePS5100520.0111158IPR003441NAC domain
PfamPF023651.7E-81254IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 58 aa     Download sequence    Send to blast
MNISVNGQSQ VPPGFRFHPT EEELLQYYLR KKISNIKIDL DVIRDVDLNK LEPWDIQG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1386424e-69AL138642.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F21F14.
GenBankCP0026864e-69CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544875.15e-34PREDICTED: NAC domain-containing protein 43
SwissprotQ9M2743e-33NAC66_ARATH; NAC domain-containing protein 66
TrEMBLA0A087GZS52e-33A0A087GZS5_ARAAL; Uncharacterized protein
TrEMBLA0A0D3CTA86e-35A0A0D3CTA8_BRAOL; Uncharacterized protein
STRINGBra007640.1-P1e-32(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61910.12e-34NAC domain protein 66